Tested Applications
Positive IP detected in | HL-60 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26447-1-AP targets SRMS in IP, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24062 Product name: Recombinant human SRMS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 418-488 aa of BC153198 Sequence: EVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP Predict reactive species |
Full Name | src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites |
Calculated Molecular Weight | 488 aa, 55 kDa |
Observed Molecular Weight | 55 kDa |
GenBank Accession Number | BC153198 |
Gene Symbol | SRMS |
Gene ID (NCBI) | 6725 |
RRID | AB_2880516 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H3Y6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SRMS antibody 26447-1-AP | Download protocol |
IP protocol for SRMS antibody 26447-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |