Tested Applications
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26447-1-AP targets SRMS in IP, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24062 Product name: Recombinant human SRMS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 418-488 aa of BC153198 Sequence: EVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP Predict reactive species |
| Full Name | src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites |
| Calculated Molecular Weight | 488 aa, 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC153198 |
| Gene Symbol | SRMS |
| Gene ID (NCBI) | 6725 |
| RRID | AB_2880516 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3Y6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SRMS antibody 26447-1-AP | Download protocol |
| IP protocol for SRMS antibody 26447-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





