Tested Applications
Positive WB detected in | HepG2 cells, A2780 cells, HeLa cells, MCF-7 cells, SKOV-3 cells, mouse colon tissue, HuH-7 cells |
Positive IP detected in | HepG2 cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 11 publications below |
IHC | See 2 publications below |
IP | See 3 publications below |
Product Information
11195-1-AP targets SRP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1683 Product name: Recombinant human SRP9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species |
Full Name | signal recognition particle 9kDa |
Calculated Molecular Weight | 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC015094 |
Gene Symbol | SRP9 |
Gene ID (NCBI) | 6726 |
RRID | AB_2239820 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P49458 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SRP9 antibody 11195-1-AP | Download protocol |
IHC protocol for SRP9 antibody 11195-1-AP | Download protocol |
IP protocol for SRP9 antibody 11195-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Exosome RNA Unshielding Couples Stromal Activation to Pattern Recognition Receptor Signaling in Cancer.
| ||
Nucleic Acids Res Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. | ||
Nucleic Acids Res The pioneer round of translation ensures proper targeting of ER and mitochondrial proteins. | ||
Nucleic Acids Res Implication of the SMN complex in the biogenesis and steady state level of the signal recognition particle. | ||
Int J Oncol Significance of signal recognition particle 9 nuclear translocation: Implications for pancreatic cancer prognosis and functionality | ||
J Proteome Res Proteomic expression analysis of surgical human colorectal cancer tissues: up-regulation of PSB7, PRDX1, and SRP9 and hypoxic adaptation in cancer. |