SRP9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SRP9 Polyclonal antibody (11195-1-AP)

• Featured Product
• KD/KO Validated

SRP9 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11195-1-AP Copied!

Publications (17)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

ALURBP, SRP9

• 

  WB analysis of HepG2 using 11195-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11195-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11195-1-AP

  WB result of SRP9 antibody (11195-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SRP9 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 11195-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 11195-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 11195-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 11195-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A2780 using 11195-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 11195-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 11195-1-AP

  IP result of anti-SRP9 (IP:11195-1-AP, 3ug; Detection:11195-1-AP 1:500) with HepG2 cells lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11195-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11195-1-AP (SRP9 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SRP9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, A2780 cells, HeLa cells, MCF-7 cells, SKOV-3 cells, mouse colon tissue, HuH-7 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11195-1-AP targets SRP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1683

  Product name: Recombinant human SRP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC015094

  Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE

• Full Name: signal recognition particle 9kDa
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC015094
• Gene Symbol: SRP9
• Gene ID (NCBI): 6726
• RRID: AB_2239820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49458
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.

Publications

What published studies show

The SRP9 antibody (Cat# 11195-1-AP) has 17 citations spanning journals including Science, Cell, Nucleic Acids Research, RNA, Journal of Biological Chemistry, International Journal of Oncology, Journal of Proteome Research, Molecular Biology Reports, Life Science Alliance, Annals of Clinical and Translational Neurology, PLoS One, and bioRxiv. Research fields cover mRNA translation and decay, signal recognition particle biology, protein targeting, cancer (pancreatic, breast, colorectal), retrotransposition, and neurology.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Mechanisms linking cytoplasmic decay of translation-defective mRNA to transcriptional adaptation.; Authors - Mohamed A El-Brolosy
human	WB	Cell; Exosome RNA Unshielding Couples Stromal Activation to Pattern Recognition Receptor Signaling in Cancer.; Authors - Barzin Y Nabet ; KD Validated
	WB	Nucleic Acids Res; The pioneer round of translation ensures proper targeting of ER and mitochondrial proteins.; Authors - Joori Park
human	WB	Nucleic Acids Res; Alu RNA fold links splicing with signal recognition particle proteins; Authors - Ivana Borovská
human	WB,IP	Nucleic Acids Res; Implication of the SMN complex in the biogenesis and steady state level of the signal recognition particle.; Authors - Piazzon Nathalie N
human	WB,IP	Nucleic Acids Res; Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR.; Authors - Evan P Booy

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating. The reviewer used it on Hek293T cells for Western Blot and Immunoprecipitation at a 1:1000 dilution, reporting simply that "it worked." Overall, the feedback is positive, indicating reliable performance in both WB and IP applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Kalodiah (Verified Customer) (09-30-2026)

It worked!

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Hek293T