SRP9 Polyclonal antibody

• 

  WB analysis of HepG2 using 11195-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11195-1-AP

  WB result of SRP9 antibody (11195-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SRP9 transfected HeLa cells.

• 

  WB analysis using 11195-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 11195-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11195-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11195-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11195-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 11195-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SKOV-3 using 11195-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 11195-1-AP (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 11195-1-AP

  IP result of anti-SRP9 (IP:11195-1-AP, 3ug; Detection:11195-1-AP 1:500) with HepG2 cells lysate 3600ug.

• 

  IHC staining of human prostate cancer using 11195-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11195-1-AP (SRP9 antibody) at dilution of 1:100 (under 10x lens).

• Featured Product
• KD/KO Validated

SRP9 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11195-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

ALURBP, SRP9

---

Tested Applications

• Positive WB detected in: HepG2 cells, A2780 cells, HeLa cells, MCF-7 cells, SKOV-3 cells, mouse colon tissue, HuH-7 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 11 publications below
• IHC: See 2 publications below
• IP: See 3 publications below

Product Information

11195-1-AP targets SRP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1683

  Product name: Recombinant human SRP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC015094

  Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE

• Full Name: signal recognition particle 9kDa
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC015094
• Gene Symbol: SRP9
• Gene ID (NCBI): 6726
• RRID: AB_2239820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49458
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Exosome RNA Unshielding Couples Stromal Activation to Pattern Recognition Receptor Signaling in Cancer.; Authors - Barzin Y Nabet ; KD Validated
human	WB,IP	Nucleic Acids Res; Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR.; Authors - Evan P Booy
	WB	Nucleic Acids Res; The pioneer round of translation ensures proper targeting of ER and mitochondrial proteins.; Authors - Joori Park
human	WB,IP	Nucleic Acids Res; Implication of the SMN complex in the biogenesis and steady state level of the signal recognition particle.; Authors - Piazzon Nathalie N
human	IHC	Int J Oncol; Significance of signal recognition particle 9 nuclear translocation: Implications for pancreatic cancer prognosis and functionality; Authors - Hiromichi Sato
human	WB	J Proteome Res; Proteomic expression analysis of surgical human colorectal cancer tissues: up-regulation of PSB7, PRDX1, and SRP9 and hypoxic adaptation in cancer.; Authors - Rho Jung-hyun JH