SRXN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SRXN1 Polyclonal antibody (14273-1-AP)

• Featured Product
• KD/KO Validated

SRXN1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14273-1-AP

Publications(36)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

C20orf139, EC:1.8.98.2, SRX, SRX1, Sulfiredoxin 1

• 

  WB analysis using 14273-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRXN1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 14273-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 14273-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A549 using 14273-1-AP

  IP result of anti-SRXN1 (IP:14273-1-AP, 4ug; Detection:14273-1-AP 1:1000) with A549 cells lysate 720 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14273-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14273-1-AP (SRX1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14273-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14273-1-AP (SRX1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14273-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14273-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14273-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14273-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, mouse liver tissue, Transfected HEK-293 cells, HepG2 cells, L02 cells, PC-3 cells, U-251 cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14273-1-AP targets SRXN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5613

  Product name: Recombinant human SRX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC047707

  Sequence: MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

• Full Name: sulfiredoxin 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC047707
• Gene Symbol: SRXN1
• Gene ID (NCBI): 140809
• RRID: AB_2195030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYN0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cancer Res; Genetic polymorphisms and protein expression of NRF2 and Sulfiredoxin predict survival outcomes in breast cancer.; Authors - Hartikainen Jaana M JM
mouse		Nat Commun; Loss of peroxiredoxin-2 exacerbates eccentric contraction-induced force loss in dystrophin-deficient muscle.; Authors - John T Olthoff
		Blood Cancer J; PMID: 27421095; Authors - K K Starheim
mouse,human	WB,IHC	Cancer Lett; Nrf2-activated expression of sulfiredoxin contributes to urethane-induced lung tumorigenesis.; Authors - Murli Mishra ; KD Validated
human	WB,IHC	Proc Natl Acad Sci U S A; Sulfiredoxin-Peroxiredoxin IV axis promotes human lung cancer progression through modulation of specific phosphokinase signaling.; Authors - Wei Qiou Q
human	WB	Osteoarthritis Cartilage; Age and oxidative stress regulate Nrf2 homeostasis in human articular chondrocytes; Authors - E L Taylor

Reviews

3.3 out of 5

3 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lucy (Verified Customer) (01-30-2026)

Worked well initially at a 1:1000 concentration, but struggled to replicate the western - there are potentially some issues with degrading over time. Non specific bands visible at 120 kDa.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Breast cancer cells

Shinford (Verified Customer) (09-23-2023)

Detecting lower molecular weight molecules in gels is relatively difficult, we tried several antibodies from different companies and this worked well at a concentration of 1:500.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Breast cancer cells

SRXN1 Antibody Western Blot validation (1:500 dilution) in Breast cancer cells (Cat no:14273-1-AP)

Christopher (Verified Customer) (12-03-2018)

Primary neurons were lysed in RIPA and 20ug samples (containing 1x Laemmli) were run on Bis-Tris gels in 1xMOPS buffer. This antibody recognised SRXN-1 in HEK293FT cells transfected with Human SRXN1 at 17kDa. In HEK cells, non specific bands were visible at around 28 and 35kDa as well.In primary neurons, the antibody recognised a band at roughly 15kDa however it binds non sepcifically to the Pageruler Prestained protein ladder which is an issue.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Primary cortical neurons and transfected HEK293FT cells