Tested Applications
| Positive WB detected in | human liver tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11817-1-AP targets SS18L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2384 Product name: Recombinant human SS18L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC017804 Sequence: MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME Predict reactive species |
| Full Name | synovial sarcoma translocation gene on chromosome 18-like 2 |
| Calculated Molecular Weight | 77 aa, 9 kDa |
| Observed Molecular Weight | 6-7 kDa |
| GenBank Accession Number | BC017804 |
| Gene Symbol | SS18L2 |
| Gene ID (NCBI) | 51188 |
| RRID | AB_2195164 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHA2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SS18L2 antibody 11817-1-AP | Download protocol |
| WB protocol for SS18L2 antibody 11817-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



