SSPN Polyclonal antibody

SSPN Polyclonal Antibody for WB, ELISA

Cat No. 26685-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DAGA5, Kirsten ras associated protein, KRAG, nanospan, NSPN, Sarcospan, SPN1, SPN2, SSPN

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis of mouse liver using 26685-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 26685-1-AP (SSPN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat liver using 26685-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 26685-1-AP (SSPN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in

mouse liver tissue, rat liver tissue

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

26685-1-AP targets SSPN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag24511 Product name: Recombinant human SSPN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC062299 Sequence: MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL Predict reactive species
Full Name	sarcospan (Kras oncogene-associated gene)
Calculated Molecular Weight	243 aa, 27 kDa
Observed Molecular Weight	15-20 kDa, 27 kDa
GenBank Accession Number	BC062299
Gene Symbol	SSPN
Gene ID (NCBI)	8082
RRID	AB_2880602
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q14714
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
WB protocol for SSPN antibody 26685-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
		Clin Transl Med Engineered exosomes improve myocardial cell membrane integrity and heart function in dystrophic cardiomyopathy. Authors - Qihong Wu View Article