Tested Applications
Positive WB detected in | mouse liver tissue, rat liver tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26685-1-AP targets SSPN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24511 Product name: Recombinant human SSPN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC062299 Sequence: MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL Predict reactive species |
Full Name | sarcospan (Kras oncogene-associated gene) |
Calculated Molecular Weight | 243 aa, 27 kDa |
Observed Molecular Weight | 15-20 kDa, 27 kDa |
GenBank Accession Number | BC062299 |
Gene Symbol | SSPN |
Gene ID (NCBI) | 8082 |
RRID | AB_2880602 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14714 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SSPN antibody 26685-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |