SSPN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SSPN Polyclonal antibody (26685-1-AP)

SSPN Polyclonal Antibody for WB, ELISA

Cat No. 26685-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DAGA5, Kirsten ras associated protein, KRAG, nanospan, NSPN, Sarcospan, SPN1, SPN2, SSPN

• 

  WB analysis of mouse liver using 26685-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26685-1-AP (SSPN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 26685-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 26685-1-AP (SSPN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SSPN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26685-1-AP targets SSPN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24511

  Product name: Recombinant human SSPN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC062299

  Sequence: MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL

• Full Name: sarcospan (Kras oncogene-associated gene)
• Calculated Molecular Weight: 243 aa, 27 kDa
• Observed Molecular Weight: 15-20 kDa, 27 kDa
• GenBank Accession Number: BC062299
• Gene Symbol: SSPN
• Gene ID (NCBI): 8082
• RRID: AB_2880602
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SSPN Polyclonal antibody (Cat# 26685-1-AP) has a total of 1 citation. It appears in Clinical and Translational Medicine (IF 7.9), published in 2026. The cited study investigates engineered exosomes for improving myocardial cell membrane integrity and heart function in dystrophic cardiomyopathy, placing the research in the fields of cardiology, exosome biology, and muscular dystrophy.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Clin Transl Med; Engineered exosomes improve myocardial cell membrane integrity and heart function in dystrophic cardiomyopathy.; Authors - Qihong Wu