SSTR5 Monoclonal antibody, PBS Only

• 

  WB analysis using 66772-1-Ig (same clone as 66772-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66772-1-Ig (SSTR5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66772-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66772-1-Ig (same clone as 66772-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66772-1-Ig (SSTR5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66772-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 66772-1-Ig (same clone as 66772-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using SSTR5 antibody (66772-1-Ig, Clone: 2B10D8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66772-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 66772-1-Ig (same clone as 66772-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using SSTR5 antibody (66772-1-Ig, Clone: 2B10D8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66772-1-PBS in a different storage buffer formulation.

SSTR5 Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 66772-1-PBS

Clone No.2B10D8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

somatostatin receptor 5, Somatostatin receptor type 5, SS 5 R, SS5 R, SS5R, SST5, SSTR5

---

Product Information

66772-1-PBS targets SSTR5 in WB, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18615

  Product name: Recombinant human SSTR5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 302-364 aa of BC146576

  Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL

• Full Name: somatostatin receptor 5
• Calculated Molecular Weight: 364 aa, 39 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC146576
• Gene Symbol: SSTR5
• Gene ID (NCBI): 6755
• RRID: AB_2882118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35346
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Somatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420).