STAP2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30516-1-AP (same clone as 30516-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30516-1-AP (STAP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30516-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30516-1-AP (same clone as 30516-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30516-1-AP (STAP2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30516-1-PBS in a different storage buffer formulation.

STAP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30516-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BKS, Breast tumor kinase substrate, BRK substrate, Signal-transducing adaptor protein 2, STAP-2

---

Product Information

30516-1-PBS targets STAP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28818

  Product name: Recombinant human STAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-403 aa of BC000795

  Sequence: VRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH

• Full Name: signal transducing adaptor family member 2
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000795
• Gene Symbol: STAP2
• Gene ID (NCBI): 55620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGK3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STAP2, also known as BKS, belongs to the signal-transducing adaptor protein (STAP) family, The family includes STAP1 and STAP2, is a group of adaptor molecules involved in regulating multiple signaling pathways. The expression level of STAP2 in tubular cells is significantly higher than that in other renal cells, accounting for approximately 70%. In tubular epithelial cells, which are primarily affected by renal injury, STAP2 is mainly localized in the cytoplasm (PMID: 39533293).