STARD10 Monoclonal antibody, PBS Only

• 

  WB analysis using 68554-1-Ig (same clone as 68554-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68554-1-Ig (STARD10 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68554-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 68554-1-Ig (same clone as 68554-1-PBS)

  IP result of anti-STARD10 (IP:68554-1-Ig, 4ug; Detection:68554-1-Ig 1:6000) with HepG2 cells lysate 1480 ug. This data was developed using the same antibody clone with 68554-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68554-1-Ig (same clone as 68554-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using STARD10 antibody (68554-1-Ig, Clone: 1B9A1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68554-1-PBS in a different storage buffer formulation.

STARD10 Monoclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 68554-1-PBS

Clone No.1B9A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Antigen NY CO 28, Antigen NY-CO-28, CGI 52, CGI-52, NY CO 28

---

Product Information

68554-1-PBS targets STARD10 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10932

  Product name: Recombinant human STARD10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-291 aa of BC007919

  Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT

• Full Name: StAR-related lipid transfer (START) domain containing 10
• Calculated Molecular Weight: 291 aa, 33 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC007919
• Gene Symbol: STARD10
• Gene ID (NCBI): 10809
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y365
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STARD10 (START domain-containing protein 10, also known as PCTP-like protein) is highly expressed in liver and responsible to transfer phosphatidylcholine. STARD10 was identified as a protein overexpressed in breast cancer that cooperates with the ErbB family of receptor tyrosine kinases in cellular transformation (PMID: 15911624). This antibody detected duplicate bands between 35-40 kDa (PMID: 15150109).