STAU2 Polyclonal antibody

• 

  WB analysis of mouse heart using 15998-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15998-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 15998-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15998-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15998-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15998-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15998-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15998-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 15998-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 15998-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15998-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 15998-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15998-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

STAU2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15998-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Double-stranded RNA-binding protein Staufen homolog 2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

15998-1-AP targets STAU2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8482

  Product name: Recombinant human STAU2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC008370

  Sequence: MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQR

• Full Name: staufen, RNA binding protein, homolog 2 (Drosophila)
• Calculated Molecular Weight: 570 aa, 62 kDa
• Observed Molecular Weight: 62-66 kDa
• GenBank Accession Number: BC008370
• Gene Symbol: STAU2
• Gene ID (NCBI): 27067
• RRID: AB_10863121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUL3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR.; Authors - Evan P Booy
mouse,human	WB	J Biol Chem; Staufen2 dysregulation in neurodegenerative disease; Authors - Sharan Paul ; KD Validated