Featured Product
KD/KO Validated

STAU2 Polyclonal antibody

STAU2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15998-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Double-stranded RNA-binding protein Staufen homolog 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse heart using 15998-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 15998-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 15998-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15998-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse heart using 15998-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse heart using 15998-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15998-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15998-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 15998-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 15998-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse heart using 15998-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 15998-1-AP (STAU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 15998-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15998-1-AP (STAU2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for STAU2 in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue
Positive IHC detected in	mouse brain tissue, rat stomach tissue, mouse kidney tissue, rat kidney tissue, human ovary cancer tissue, mouse colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15998-1-AP targets STAU2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8482 Product name: Recombinant human STAU2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC008370 Sequence: MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQR Predict reactive species
Full Name	staufen, RNA binding protein, homolog 2 (Drosophila)
Calculated Molecular Weight	570 aa, 62 kDa
Observed Molecular Weight	62-66 kDa
GenBank Accession Number	BC008370
Gene Symbol	STAU2
Gene ID (NCBI)	27067
RRID	AB_10863121
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NUL3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for STAU2 antibody 15998-1-AP	Download protocol
WB protocol for STAU2 antibody 15998-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The STAU2 Polyclonal antibody (Cat# 15998-1-AP) has 4 citations. They appear in Nucleic Acids Research, Advanced Science (two), and Journal of Biological Chemistry. Research fields include ribonucleoprotein regulation (BC200/CSDE1), pancreatic ductal adenocarcinoma and EMT signaling, mRNA translation/transport in neuronal development and plasticity, and Staufen2 dysregulation in neurodegenerative disease. Applications span WB, IP, and IHC in human and mouse.

Species	Application	Title
human	WB	Nucleic Acids Res Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. Authors - Evan P Booy View Article
human	WB,IP	Adv Sci (Weinh) ASO Therapy Targeting STAU2 to Inhibit Pancreatic Ductal Adenocarcinoma Progression and Metastasis by Regulating the PALLD-Mediated EMT Signaling Pathway. Authors - Jiayu Ding KD Validated View Article
mouse	IHC	Adv Sci (Weinh) Fine-Tuned Regulation of mRNA Translation and Transport by STAU2 Condensate Facilitates Neuronal Development and Plasticity. Authors - Shijing Huang View Article
mouse,human	WB	J Biol Chem Staufen2 dysregulation in neurodegenerative disease Authors - Sharan Paul KD Validated View Article