Tested Applications
Positive WB detected in | A431 cells, DU 145 cells |
Positive IP detected in | LNCaP cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
20199-1-AP targets STEAP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14134 Product name: Recombinant human STEAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC011802 Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI Predict reactive species |
Full Name | six transmembrane epithelial antigen of the prostate 1 |
Calculated Molecular Weight | 339 aa, 40 kDa |
Observed Molecular Weight | 38-40 kDa |
GenBank Accession Number | BC011802 |
Gene Symbol | STEAP1 |
Gene ID (NCBI) | 26872 |
RRID | AB_11182488 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UHE8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STEAP1 antibody 20199-1-AP | Download protocol |
IHC protocol for STEAP1 antibody 20199-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Dis METTL3-mediated m6A modification of STEAP2 mRNA inhibits papillary thyroid cancer progress by blocking the Hedgehog signaling pathway and epithelial-to-mesenchymal transition. | ||
Cancer Biol Ther STEAP2 promotes osteosarcoma progression by inducing epithelial–mesenchymal transition via the PI3K/AKT/mTOR signaling pathway and is regulated by EFEMP2 |