STEAP2 Polyclonal antibody

• 

  WB analysis using 24804-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24804-1-AP (STEAP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 24804-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24804-1-AP (STEAP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 24804-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24804-1-AP (STEAP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

STEAP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24804-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

PUMPCn, Protein up-regulated in metastatic prostate cancer, Prostate cancer-associated protein 1, PCANAP1, Metalloreductase STEAP2

---

Tested Applications

• Positive WB detected in: DU 145 cells, HEK-293T cells, U2OS cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:800-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24804-1-AP targets STEAP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20293

  Product name: Recombinant human STEAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-265 aa of BC148824

  Sequence: QLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAIT

• Full Name: six transmembrane epithelial antigen of the prostate 2
• Calculated Molecular Weight: 490 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC148824
• Gene Symbol: STEAP2
• Gene ID (NCBI): 261729
• RRID: AB_3085755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STEAP2, also named as PCANAP1 and STAMP1, belongs to the STEAP family. It is a metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. STEAP2 uses NAD+ as acceptor.