Tested Applications
Positive WB detected in | DU 145 cells, HEK-293T cells, U2OS cells |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:800-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24804-1-AP targets STEAP2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20293 Product name: Recombinant human STEAP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-265 aa of BC148824 Sequence: QLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAIT Predict reactive species |
Full Name | six transmembrane epithelial antigen of the prostate 2 |
Calculated Molecular Weight | 490 aa, 56 kDa |
Observed Molecular Weight | 56 kDa |
GenBank Accession Number | BC148824 |
Gene Symbol | STEAP2 |
Gene ID (NCBI) | 261729 |
RRID | AB_3085755 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NFT2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STEAP2, also named as PCANAP1 and STAMP1, belongs to the STEAP family. It is a metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. STEAP2 uses NAD+ as acceptor.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STEAP2 antibody 24804-1-AP | Download protocol |
IHC protocol for STEAP2 antibody 24804-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |