• Featured Product
  • KD/KO Validated

STK11/LKB1 Polyclonal antibody, PBS Only

STK11/LKB1 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 29323-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29323-1-PBS targets STK11/LKB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30903

Product name: Recombinant human STK11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 281-428 aa of BC007981

Sequence: PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLS

Predict reactive species
Full Name serine/threonine kinase 11
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC007981
Gene Symbol LKB1
Gene ID (NCBI) 6794
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15831
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

STK11(serine/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification.

Loading...
||
New chat Able
正在加载,请稍候...