STK11/LKB1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• STK11/LKB1 Polyclonal antibody (29323-1-AP)

• Featured Product
• KD/KO Validated

STK11/LKB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29323-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

LKB1, PJS, serine/threonine kinase 11, STK11

• 

  WB analysis using 29323-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29323-1-AP (STK11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 29323-1-AP

  WB result of STK11/LKB1 antibody (29323-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STK11/LKB1 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 29323-1-AP

  WB result of STK11/LKB1 antibody (29323-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STK11/LKB1 transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 29323-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29323-1-AP (STK11/LKB1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, MCF-7 cells, HEK-293T cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse testis tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29323-1-AP targets STK11/LKB1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30903

  Product name: Recombinant human STK11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-428 aa of BC007981

  Sequence: PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLS

• Full Name: serine/threonine kinase 11
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC007981
• Gene Symbol: LKB1
• Gene ID (NCBI): 6794
• RRID: AB_2923591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STK11(serine/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Free Radic Res; Apelin deficiency exacerbates cardiac injury following infarction by accelerating cardiomyocyte ferroptosis; Authors - Yuechu Zhao
		Endocrine; STK11 c.1062 C > G germline variant in medullary thyroid carcinoma: implications for familial predisposition and genetic counseling.; Authors - Weimao Kong