STK24 Monoclonal antibody, PBS Only

• 

  WB analysis using 68522-1-Ig (same clone as 68522-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68522-1-Ig (STK24 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68522-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 68522-1-Ig (same clone as 68522-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using STK24 antibody (68522-1-Ig, Clone: 2B4C1 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68522-1-PBS in a different storage buffer formulation.

STK24 Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 68522-1-PBS

Clone No.2B4C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

Serine/threonine-protein kinase 24 36 kDa subunit, Serine/threonine-protein kinase 24 12 kDa subunit, MST3, Mammalian STE20-like protein kinase 3, EC:2.7.11.1

---

Product Information

68522-1-PBS targets STK24 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31526

  Product name: Recombinant human STK24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 320-443 aa of NM_003576

  Sequence: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH

• Full Name: serine/threonine kinase 24 (STE20 homolog, yeast)
• Calculated Molecular Weight: 49KD
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_003576
• Gene Symbol: STK24
• Gene ID (NCBI): 8428
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y6E0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Serine/threonine-protein kinase 24 (STK24), also named MST3, belonging to GCK subfamily of STE20-like kinases, acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation (PubMed: 10644707, PMID:12107159). STK24 and STK25 operate in the same cardiovascular development pathway with programmed cell death 10 (CCM3) (PMID: 20332113). It regulates axon outgrowth in forebrain neurons (PubMed: 17114295).