Product Information
16116-1-AP targets STRA13 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9044 Product name: Recombinant human STRA13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC009571 Sequence: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLLLDF Predict reactive species |
| Full Name | stimulated by retinoic acid 13 homolog (mouse) |
| Calculated Molecular Weight | 63 aa, 7 kDa |
| GenBank Accession Number | BC009571 |
| Gene Symbol | STRA13 |
| Gene ID (NCBI) | 201254 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A8MT69 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STRA13, also named as CENPX, FAAP10 and MHF2, is a centromere protein with MW 10 kDa. It is recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. STRA13 may be involved as a repressor in a number of decision events occurring during differentiation of various cell lineages.
