STRN3 Polyclonal antibody

• 

  WB analysis using 23966-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23966-1-AP (STRN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse stomach using 23966-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23966-1-AP (STRN3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 23966-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23966-1-AP (STRN3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

STRN3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23966-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Striatin-3, Striatin3, Striatin 3, SG2NA, PPP2R6B

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

23966-1-AP targets STRN3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21091

  Product name: Recombinant human STRN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-300 aa of BC126221

  Sequence: SNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE

• Full Name: striatin, calmodulin binding protein 3
• Calculated Molecular Weight: 797 aa, 87 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC126221
• Gene Symbol: STRN3
• Gene ID (NCBI): 29966
• RRID: AB_2879379
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q13033
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Mol Biol Cell; Spatial proximity of proteins surrounding zyxin under force-bearing conditions.; Authors - Joleen S Cheah
human	WB,IF	STAR Protoc; Protocol using lentivirus to establish THP-1 suspension cell lines for immunostaining and confocal microscopy; Authors - Wangsheng Ji
human	WB	Genes Genomics; LncRNA KTN1-AS1 facilitates esophageal squamous cell carcinoma progression via miR-885-5p/STRN3 axis; Authors - Liying Chen
human	WB	Adv Sci (Weinh); TRAF3IP3 Induces ER Stress-Mediated Apoptosis with Protective Autophagy to Inhibit Lung Adenocarcinoma Proliferation; Authors - Guang Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joleen (Verified Customer) (05-04-2019)

Works well with Western Blot but requires long exposure >100s. Some nonspecific band but still not dirty.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

STRN3 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:23966-1-AP)