Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23966-1-AP targets STRN3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21091 Product name: Recombinant human STRN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-300 aa of BC126221 Sequence: SNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE Predict reactive species |
| Full Name | striatin, calmodulin binding protein 3 |
| Calculated Molecular Weight | 797 aa, 87 kDa |
| Observed Molecular Weight | 90-100 kDa |
| GenBank Accession Number | BC126221 |
| Gene Symbol | STRN3 |
| Gene ID (NCBI) | 29966 |
| RRID | AB_2879379 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q13033 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for STRN3 antibody 23966-1-AP | Download protocol |
| WB protocol for STRN3 antibody 23966-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The STRN3 Polyclonal antibody (Cat# 23966-1-AP) has 5 citations published in Advanced Science, Oncogene, Molecular Biology of the Cell, Genes & Genomics, and STAR Protocols. The associated research spans cancer biology (lung adenocarcinoma, esophageal squamous cell carcinoma), cell signaling (Hippo pathway, focal adhesion), ER stress-mediated apoptosis with protective autophagy, and spatial protein organization under mechanical force. Applications cited include WB, CoIP, and IF.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) TRAF3IP3 Induces ER Stress-Mediated Apoptosis with Protective Autophagy to Inhibit Lung Adenocarcinoma Proliferation | ||
Oncogene Oncogenic LPP facilitates focal adhesion maturation in response to mechanical tension and regulates the Hippo signaling. | ||
Mol Biol Cell Spatial proximity of proteins surrounding zyxin under force-bearing conditions. | ||
Genes Genomics LncRNA KTN1-AS1 facilitates esophageal squamous cell carcinoma progression via miR-885-5p/STRN3 axis | ||
STAR Protoc Protocol using lentivirus to establish THP-1 suspension cell lines for immunostaining and confocal microscopy |
Reviews
What customers say
One reviewer (Joleen Cheah, May 2019) rated this antibody 4 out of 5 stars for Western Blot on MDCK GII cells at a 1:1,000 dilution. She reported that it works well but requires a long exposure time of over 100 seconds to visualize the target band. While some nonspecific bands were observed, she noted the overall result was still clean and acceptable.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (05-04-2019) | Works well with Western Blot but requires long exposure >100s. Some nonspecific band but still not dirty.
 |
