Tested Applications
Positive WB detected in | HeLa cells |
Positive IHC detected in | mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IF | See 1 publications below |
Product Information
23966-1-AP targets STRN3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21091 Product name: Recombinant human STRN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-300 aa of BC126221 Sequence: SNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE Predict reactive species |
Full Name | striatin, calmodulin binding protein 3 |
Calculated Molecular Weight | 797 aa, 87 kDa |
Observed Molecular Weight | 90-100 kDa |
GenBank Accession Number | BC126221 |
Gene Symbol | STRN3 |
Gene ID (NCBI) | 29966 |
RRID | AB_2879379 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q13033 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STRN3 antibody 23966-1-AP | Download protocol |
IHC protocol for STRN3 antibody 23966-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Biol Cell Spatial proximity of proteins surrounding zyxin under force-bearing conditions. | ||
STAR Protoc Protocol using lentivirus to establish THP-1 suspension cell lines for immunostaining and confocal microscopy | ||
Genes Genomics LncRNA KTN1-AS1 facilitates esophageal squamous cell carcinoma progression via miR-885-5p/STRN3 axis | ||
Adv Sci (Weinh) TRAF3IP3 Induces ER Stress-Mediated Apoptosis with Protective Autophagy to Inhibit Lung Adenocarcinoma Proliferation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Joleen (Verified Customer) (05-04-2019) | Works well with Western Blot but requires long exposure >100s. Some nonspecific band but still not dirty.
![]() |