Syntaxin 1B Recombinant monoclonal antibody, PBS Only (Capture)

Syntaxin 1B Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83298-1-PBS
Clone No.240156B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Syntaxin 1B, STX1B, Syntaxin 1A, 240156B9, STX1B1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83298-1-PBS targets Syntaxin 1B as part of a matched antibody pair:

MP00312-1: 83298-1-PBS capture and 83298-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10275

Product name: Recombinant human STX1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-263 aa of BC062298

Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK

Predict reactive species
Full Name syntaxin 1B
Calculated Molecular Weight 288 aa, 33 kDa
Observed Molecular Weight 33-35 kDa
GenBank Accession NumberBC062298
Gene Symbol STX1B
Gene ID (NCBI) 112755
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61266
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and endocytic pathways (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641).

Loading...
||
New chat

Able

正在加载,请稍候...