STXBP5 Polyclonal antibody

• 

  WB analysis using 24512-1-AP

  Mouse brain tissue was subjected to SDS PAGE, followed by western blot with 24512-1-AP (STXBP5 antibody) at a dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 24512-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 24512-1-AP (STXBP5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of rat brain using 24512-1-AP

  IP result of anti-STXBP5 (IP:24512-1-AP, 5ug; Detection:24512-1-AP 1:300) with rat brain tissue lysate 4000ug.

• 

  IF Staining of SH-SY5Y using 24512-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using STXBP5 antibody (24512-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HUVEC using 24512-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HUVEC cells using STXBP5 antibody (24512-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

STXBP5 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 24512-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Lethal(2) giant larvae protein homolog 3, LLGL3, Syntaxin-binding protein 5, Tomosyn-1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: rat brain tissue
• Positive IF/ICC detected in: SH-SY5Y cells, HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

24512-1-AP targets STXBP5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21629

  Product name: Recombinant human STXBP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 515-610 aa of BC113382

  Sequence: MLCIAGVSAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCLKVKNSPLKQS

• Full Name: syntaxin binding protein 5 (tomosyn)
• Calculated Molecular Weight: 1151 aa, 128 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC113382
• Gene Symbol: STXBP5
• Gene ID (NCBI): 134957
• RRID: AB_2879582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T5C0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntaxin-binding protein 5 (STXBP5, also known as tomosyn) is a cytosolic syntaxin-binding protein that can displace MUNC18 from syntaxin-1. It is a soluble R-SNARE protein that sequesters target SNAREs through the C-terminal VAMP-like domain. STXBP5 plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; The syntaxin-binding protein STXBP5 regulates progerin expression; Authors - Hongqian Qi ; KD Validated