Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IP detected in | rat brain tissue |
Positive IF/ICC detected in | SH-SY5Y cells, HUVEC cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
24512-1-AP targets STXBP5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21629 Product name: Recombinant human STXBP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 515-610 aa of BC113382 Sequence: MLCIAGVSAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCLKVKNSPLKQS Predict reactive species |
Full Name | syntaxin binding protein 5 (tomosyn) |
Calculated Molecular Weight | 1151 aa, 128 kDa |
Observed Molecular Weight | 130 kDa |
GenBank Accession Number | BC113382 |
Gene Symbol | STXBP5 |
Gene ID (NCBI) | 134957 |
RRID | AB_2879582 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5T5C0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Syntaxin-binding protein 5 (STXBP5, also known as tomosyn) is a cytosolic syntaxin-binding protein that can displace MUNC18 from syntaxin-1. It is a soluble R-SNARE protein that sequesters target SNAREs through the C-terminal VAMP-like domain. STXBP5 plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STXBP5 antibody 24512-1-AP | Download protocol |
IF protocol for STXBP5 antibody 24512-1-AP | Download protocol |
IP protocol for STXBP5 antibody 24512-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |