Tested Applications
| Positive IHC detected in | mouse kidney tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31987-1-AP targets SUCNR1/GPR91 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34053 Product name: Recombinant human SUCNR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 282-334 aa of BC030948 Sequence: PLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Predict reactive species |
| Full Name | succinate receptor 1 |
| GenBank Accession Number | BC030948 |
| Gene Symbol | SUCNR1 |
| Gene ID (NCBI) | 56670 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BXA5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SUCNR1 (Succinate Receptor 1), also known as GPR91, belongs to the family of G protein-coupled receptors (GPCRs) (PMID: 26808164). SUCNR1 has been identified as a receptor for the metabolite succinate, which functions as a metabolic stress signal in various tissues, including the liver, kidney, adipose tissue, and retina (PMID: 29968758). SUCNR1 is crucial in linking metabolic stress, inflammation, and energy homeostasis. It mediates signaling through Gq/GNAQ or Gi/GNAI second messengers, depending on the cell type and regulated processes.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SUCNR1/GPR91 antibody 31987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



