SUMO1 Polyclonal antibody

SUMO1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10329-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

GAP-modifying protein 1, GMP1, OK/SW-cl.43, Sentrin, Small ubiquitin related modifier 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, NIH/3T3 cells, PC-12 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10329-1-AP targets SUMO1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0414

Product name: Recombinant human SUMO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC006462

Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae)
Calculated Molecular Weight 12 kDa
Observed Molecular Weight12~18 kDa, 80-90 kDa
GenBank Accession NumberBC006462
Gene Symbol SUMO1
Gene ID (NCBI) 7341
RRIDAB_2286872
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63165
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Small ubiquitin-related modifier 1 (SUMO1) belongs to the ubiquitin family and the SUMO subfamily as it contains 1 ubiquitin-like domain and is also 18% identical to ubiquitin (PMID: 9654451).

1. What is the molecular weight of SUMO1?

The molecular weight of SUMO1 is 12 kDa.

2. What is the cellular localization of SUMO1?

SUMO1 is located in the nuclear membrane and is recruited by BCL11A to the nuclear body (PMID: 18681895).

3. What modifications is SUMO1 subjected to?

SUMO1 function occurs after the cleavage of its precursor form by SENP1 or SENP2 (PMID: 27576863). Polymeric SUMO1 chains also undergo polyubiquitination by RNF4 (PMID: 18408734).

4. What is the function of SUMO1?

SUMO1 post-translationally modifies many proteins that have roles in an array of processes including transcriptional regulation, chromatin structure, and DNA repair. SUMO1 can covalently attach itself to protein as a monomer or a lysine-linked polymer via an isopeptide bond (PMID:11124955). This SUMO modification can regulate the localization and activity of the affected proteins.

5. What is SUMO1's involvement in disease?

Defects in SUMO1 as a result of a chromosomal translocation are associated with non-syndromic orofacial cleft type 10, or non-syndromic cleft lip, and are associated with cleft palate in two-thirds of cases (PMID: 18983974).


Protocols

Product Specific Protocols
IF protocol for SUMO1 antibody 10329-1-APDownload protocol
IHC protocol for SUMO1 antibody 10329-1-APDownload protocol
IP protocol for SUMO1 antibody 10329-1-APDownload protocol
WB protocol for SUMO1 antibody 10329-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanCoIP

Acta Pharm Sin B

SAE1 promotes tumor cell malignancy via SUMOylation and liquid-liquid phase separation facilitated nuclear export of p27

Authors - Ling Wang
humanWB

Sci Adv

XAF1 promotes anti-RNA virus immune responses by regulating chromatin accessibility

Authors - Ming Kuang
humanWB

Cell Death Differ

ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity

Authors - Feng Xu
mouse,humanWB

Cell Death Dis

Ubc9 regulates the expression of MHC II in dendritic cells to enhance DSS-induced colitis by mediating RBPJ SUMOylation

Authors - Jing Zhang
humanWB,IF

Int J Biol Macromol

SUMOylation of GMFB regulates its stability and function in retinal pigment epithelial cells under hyperglycemia

Authors - Wan Sun
humanWB

Theranostics

Chlorogenic acid effectively treats cancers through induction of cancer cell differentiation.

Authors - Shuai Huang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Zoe (Verified Customer) (10-08-2021)

Hadn’t previously had much luck with antibodies on my Tricky construct so was great to use this one!

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...