SVIP Polyclonal antibody

• 

  WB analysis using 32511-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32511-1-AP (SVIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SVIP Polyclonal Antibody for WB, ELISA

Cat No. 32511-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Small VCP/p97-interacting protein

---

Tested Applications

• Positive WB detected in: PANC-1 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32511-1-AP targets SVIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36618

  Product name: Recombinant human SVIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-77 aa of NM_001320340

  Sequence: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS

• Full Name: small VCP/p97-interacting protein
• Calculated Molecular Weight: 8kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: NM_001320340
• Gene Symbol: SVIP
• Gene ID (NCBI): 258010
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NHG7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SVIP (Small VCP-interacting protein) is a 9-Kda adaptor endoplasmic reticulum protein that could bind directly to p97/VCP. SVIP is located on the ER membrane's cytosolic surface. It inhibits the ERAD pathway, which is known independently of ubiquitin, by interacting with p97/VCP, which has a central role in this pathway. Especially for the ERAD pathway, the SVIP protein has been identified as a negative regulator. SVIP was identified as a novel adapter protein for p97/VCP by observing its overexpression in cells, which causes extensive vacuolation and deformation of the ER and microtubules (PMID: 39473740).