Tested Applications
| Positive WB detected in | PANC-1 cells, mouse brain tissue, mouse pancreas tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32511-1-AP targets SVIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36618 Product name: Recombinant human SVIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of NM_001320340 Sequence: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS Predict reactive species |
| Full Name | small VCP/p97-interacting protein |
| Calculated Molecular Weight | 8kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_001320340 |
| Gene Symbol | SVIP |
| Gene ID (NCBI) | 258010 |
| RRID | AB_3742639 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8NHG7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SVIP (Small VCP-interacting protein) is a 9-Kda adaptor endoplasmic reticulum protein that could bind directly to p97/VCP. SVIP is located on the ER membrane's cytosolic surface. It inhibits the ERAD pathway, which is known independently of ubiquitin, by interacting with p97/VCP, which has a central role in this pathway. Especially for the ERAD pathway, the SVIP protein has been identified as a negative regulator. SVIP was identified as a novel adapter protein for p97/VCP by observing its overexpression in cells, which causes extensive vacuolation and deformation of the ER and microtubules (PMID: 39473740).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SVIP antibody 32511-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
One reviewer, Andrew Metcalfe, rated this product 5 stars in March 2026. He used it at a 1:1500 dilution on PANC1 cells for Western Blot and reported good signal. Overall, the feedback is positive, with the user confirming reliable performance in his application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrew (Verified Customer) (03-05-2026) | Good signal
|
