SYCN Polyclonal antibody

• 

  WB analysis using 26662-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26662-1-AP (SYCN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

SYCN Polyclonal Antibody for WB, ELISA

Cat No. 26662-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

INSSA1, SYCN, SYL, syncollin

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26662-1-AP targets SYCN in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24489

  Product name: Recombinant human SYCN protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 25-134 aa of BC121075

  Sequence: ASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLPSNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS

• Full Name: syncollin
• Calculated Molecular Weight: 134 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC121075
• Gene Symbol: SYCN
• Gene ID (NCBI): 342898
• RRID: AB_3669561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q0VAF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SYCN (Syncollin) functions in exocytosis in pancreatic acinar cells regulating the fusion of zymogen granules with each other. It also may have a pore-forming activity on membranes and regulate exocytosis in other exocrine tissues.