Tested Applications
| Positive WB detected in | K-562 cells, THP-1 cells |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30443-1-AP targets SYNCRIP in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31509 Product name: Recombinant human SYNCRIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 382-527 aa of BC032643 Sequence: KAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGQGKGVEAGPDLLQ Predict reactive species |
| Full Name | synaptotagmin binding, cytoplasmic RNA interacting protein |
| Calculated Molecular Weight | 623 aa, 70 kDa |
| Observed Molecular Weight | 62-74 kDa |
| GenBank Accession Number | BC032643 |
| Gene Symbol | SYNCRIP |
| Gene ID (NCBI) | 10492 |
| RRID | AB_3086317 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60506 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Synaptotagmin-binding, cytoplasmic RNA-interacting protein(SYNCRIP), also identified as hnRNP Q, involves in mRNA processing mechanisms. It's component of the CRD-mediated complex that promotes MYC mRNA stability. Also it is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. As previously reported, the 65 and 74 kDa proteins corresponded to two isoforms of SYNCRIP produced from alternatively spliced mRNAs (PMID: 15340051).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SYNCRIP antibody 30443-1-AP | Download protocol |
| WB protocol for SYNCRIP antibody 30443-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



