Use Able AI chat for product recommendations

SYNCRIP Polyclonal antibody

SYNCRIP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30443-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Glycine- and tyrosine-rich RNA-binding protein, GRY RBP, GRY-RBP, hnRNP Q, HNRPQ

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, THP-1 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30443-1-AP targets SYNCRIP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31509

Product name: Recombinant human SYNCRIP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 382-527 aa of BC032643

Sequence: KAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGQGKGVEAGPDLLQ

Predict reactive species
Full Name synaptotagmin binding, cytoplasmic RNA interacting protein
Calculated Molecular Weight 623 aa, 70 kDa
Observed Molecular Weight62-74 kDa
GenBank Accession NumberBC032643
Gene Symbol SYNCRIP
Gene ID (NCBI) 10492
RRIDAB_3086317
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60506
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Synaptotagmin-binding, cytoplasmic RNA-interacting protein(SYNCRIP), also identified as hnRNP Q, involves in mRNA processing mechanisms. It's component of the CRD-mediated complex that promotes MYC mRNA stability. Also it is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. As previously reported, the 65 and 74 kDa proteins corresponded to two isoforms of SYNCRIP produced from alternatively spliced mRNAs (PMID: 15340051).

Protocols

Product Specific Protocols
IF protocol for SYNCRIP antibody 30443-1-APDownload protocol
IHC protocol for SYNCRIP antibody 30443-1-APDownload protocol
WB protocol for SYNCRIP antibody 30443-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...