Product Information
68176-1-PBS targets SYNGR1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31309 Product name: Recombinant human SYNGR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-92 aa of BC000731 Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYF Predict reactive species |
| Full Name | synaptogyrin 1 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC000731 |
| Gene Symbol | SYNGR1 |
| Gene ID (NCBI) | 9145 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O43759 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Synaptogyrins are one of the most abundant vesicle components and are involved in the regulation of neurotransmitter release and synaptic plasticity. Synaptogyrins comprise a family of tyrosine-phosphorylated proteins with three isoforms: two neuronal forms (synaptogyrin-1 and -3) and one ubiquitous form (synaptogyrin-2). The synaptogyrin 1 (SYNGR1) can act as a regulator of Ca2+-dependent exocytosis. SYNGR1 protein mutations are associated with schizophrenia and are considered to be positional candidate genes for schizophrenia.(PMID: 10383386; 10595519; 14755516; 14732601; 17049558)









