Filter:
Tested Applications
| Positive WB detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25145-1-AP targets SYPL1 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18482 Product name: Recombinant human SYPL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 33-92 aa of BC020938 Sequence: CGGFKGQTEIQVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGD Predict reactive species |
| Full Name | synaptophysin-like 1 |
| Calculated Molecular Weight | 259 aa, 29 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC020938 |
| Gene Symbol | SYPL1 |
| Gene ID (NCBI) | 6856 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16563 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Synaptophysin-like 1 (pantophysin, SYPL1), a neuroendocrine-related protein, is abundant in adipocytes and is found in cellular membrane compartments overlapping with those containing the insulin-sensitive glucose transporter type 4 (GLUT4) .SYLP1, which is also found in both neuronal and non-neuronal tissues, plays an important role in inflammation, tumor proliferation, and progression.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SYPL1 antibody 25145-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
