SYTL5 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 24528-1-AP (same clone as 24528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24528-1-AP (SYTL5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24528-1-AP (same clone as 24528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24528-1-AP (SYTL5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24528-1-AP (same clone as 24528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24528-1-AP (SYTL5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24528-1-AP (same clone as 24528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24528-1-AP (SYTL5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24528-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 24528-1-AP (same clone as 24528-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using SYTL5 antibody (24528-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24528-1-PBS in a different storage buffer formulation.

SYTL5 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 24528-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

24528-1-PBS targets SYTL5 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21698

  Product name: Recombinant human SYTL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 56-343 aa of BC131585

  Sequence: TQQEASRVCVHCHRNLGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVRQSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYGFENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSI

• Full Name: synaptotagmin-like 5
• Calculated Molecular Weight: 730 aa, 81 kDa
• GenBank Accession Number: BC131585
• Gene Symbol: SYTL5
• Gene ID (NCBI): 94122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDW5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SYTL5, also known as SLP5, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by the presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL5 promotes the development and progression of papillary thyroid carcinoma (PTC) by activating the NF-κB signaling pathway (PMID: 36378561).