Tested Applications
| Positive IHC detected in | human liver cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23125-1-AP targets SCT in IF, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19419 Product name: Recombinant human SCT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-121 aa of BC146571 Sequence: ARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR Predict reactive species |
| Full Name | SCT |
| Calculated Molecular Weight | 121 aa, 13 kDa |
| GenBank Accession Number | BC146571 |
| Gene Symbol | SCT |
| Gene ID (NCBI) | 6343 |
| RRID | AB_2879214 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P09683 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SCT antibody 23125-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Rabbit anti-Secretin Polyclonal Antibody (Cat# 23125-1-AP) has 1 total citation. It appears in the journal Tissue Cell (IF 3.1, published 2014). The associated research field is pancreatic endocrinology and comparative cell biology, specifically investigating amylin-like immunoreactivity in pancreatic X cells of the black-spotted frog (Pelophylax nigromaculata).
| Species | Application | Title |
|---|---|---|
Tissue Cell Amylin-like immunoreactivity in pancreatic X cells of the black-spotted frog Rana (Pelophylax) nigromaculata. |
Reviews
What customers say
One customer rated this antibody 4 out of 5 stars for IHC on liver tissue at a 1:100 dilution. The reviewer described it as "good for IHC," indicating satisfactory performance in immunohistochemistry applications. Overall, the limited feedback suggests the product works well for IHC but has not yet been extensively reviewed by the broader research community.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-13-2025) | goof for IHC
|
