Secretogranin V Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 10761-1-AP (same clone as 10761-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10761-1-AP (Secretogranin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat pancreas using 10761-1-AP (same clone as 10761-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat pancreas using 10761-1-AP (same clone as 10761-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary adenoma using 10761-1-AP (same clone as 10761-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary adenoma using 10761-1-AP (same clone as 10761-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 10761-1-AP (same clone as 10761-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 10761-1-AP (same clone as 10761-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-12 using 10761-1-AP (same clone as 10761-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-12 cells using 10761-1-AP (Secretogranin V antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10761-1-PBS in a different storage buffer formulation.

Secretogranin V Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 10761-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10761-1-PBS targets Secretogranin V in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1107

  Product name: Recombinant human SCG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC005349

  Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

• Full Name: secretogranin V (7B2 protein)
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC005349
• Gene Symbol: Secretogranin V
• Gene ID (NCBI): 6447
• RRID: AB_2183280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05408
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.