Secretogranin V Polyclonal antibody

Secretogranin V Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 10761-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

SCG5, Secretogranin-5, N-terminal peptide, Neuroendocrine protein 7B2, C-terminal peptide

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inrat pancreas tissue, human pituitary adenoma tissue, mouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10761-1-AP targets Secretogranin V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1107

Product name: Recombinant human SCG5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC005349

Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

Predict reactive species
Full Name secretogranin V (7B2 protein)
Calculated Molecular Weight 24 kDa
GenBank Accession NumberBC005349
Gene Symbol Secretogranin V
Gene ID (NCBI) 6447
RRIDAB_2183280
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05408
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for Secretogranin V antibody 10761-1-APDownload protocol
IHC protocol for Secretogranin V antibody 10761-1-APDownload protocol
WB protocol for Secretogranin V antibody 10761-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Oncotarget

Bromodomain protein BRD4 inhibitor JQ1 regulates potential prognostic molecules in advanced renal cell carcinoma.

Authors - Takashi Sakaguchi
mouseWB

Aging (Albany NY)

Plumbagin has an inhibitory effect on the growth of TSCC PDX model and it enhances the anticancer efficacy of cisplatin

Authors - Yuqi Xin
humanWB,IHC

Dis Esophagus

Expression profile and function of secretogranin V, and its effects on the malignant behavior of esophageal squamous cell carcinoma

Authors - Mohammad Hussain Hamrah
  • KD Validated
mouseIF

Diabetologia

Transcriptomic heterogeneity of non-beta islet cells is associated with type 2 diabetes development in mouse models

Authors - Pascal Gottmann
Loading...
||
New chat Able
正在加载,请稍候...