Secretogranin V Polyclonal antibody

• 

  WB analysis of mouse brain using 10761-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10761-1-AP (Secretogranin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat pancreas using 10761-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat pancreas using 10761-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary adenoma using 10761-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary adenoma using 10761-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 10761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 10761-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10761-1-AP (Secretogranin V antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-12 using 10761-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-12 cells using 10761-1-AP (Secretogranin V antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

Secretogranin V Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 10761-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SCG5, Secretogranin-5, N-terminal peptide, Neuroendocrine protein 7B2, C-terminal peptide

---

Tested Applications

• Positive IHC detected in: rat pancreas tissue, human pituitary adenoma tissue, mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

10761-1-AP targets Secretogranin V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1107

  Product name: Recombinant human SCG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC005349

  Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

• Full Name: secretogranin V (7B2 protein)
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC005349
• Gene Symbol: Secretogranin V
• Gene ID (NCBI): 6447
• RRID: AB_2183280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05408
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncotarget; Bromodomain protein BRD4 inhibitor JQ1 regulates potential prognostic molecules in advanced renal cell carcinoma.; Authors - Takashi Sakaguchi
mouse	WB	Aging (Albany NY); Plumbagin has an inhibitory effect on the growth of TSCC PDX model and it enhances the anticancer efficacy of cisplatin; Authors - Yuqi Xin
human	WB,IHC	Dis Esophagus; Expression profile and function of secretogranin V, and its effects on the malignant behavior of esophageal squamous cell carcinoma; Authors - Mohammad Hussain Hamrah ; KD Validated
mouse	IF	Diabetologia; Transcriptomic heterogeneity of non-beta islet cells is associated with type 2 diabetes development in mouse models; Authors - Pascal Gottmann