Tested Applications
Positive WB detected in | SH-SY5Y cells, THP-1 cells, mouse pancreas tissue, Caco-2 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 7 publications below |
Product Information
17942-1-AP targets Neurokinin-1 receptor in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12368 Product name: Recombinant human TACR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 304-407 aa of BC074911 Sequence: IYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS Predict reactive species |
Full Name | tachykinin receptor 1 |
Calculated Molecular Weight | 407 aa, 46 kDa |
Observed Molecular Weight | 45-55 kDa |
GenBank Accession Number | BC074911 |
Gene Symbol | Neurokinin-1 receptor |
Gene ID (NCBI) | 6869 |
RRID | AB_2200611 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25103 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
neurokinin 1 receptor (NK1R, also known as the tachykinin 1 receptor, TACR1), a mediator of behavioral stress responses, in alcohol dependence and treatment. One such neurotransmitter is substance P (SP), which together with its preferred TACR1 is highly expressed in brain areas involved in stress responses and drug reward, including the hypothalamus, amygdala, and nucleus accumbens (PMID: 18276852).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Neurokinin-1 receptor antibody 17942-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Phytomedicine Differential effect of polysaccharide and nonpolysaccharide components in Sijunzi decoction on spleen deficiency syndrome and their mechanisms. | ||
PLoS One Hemokinin-1(4-11)-Induced Analgesia Selectively Up-Regulates δ-Opioid Receptor Expression in Mice. | ||
J Neuroimmunol Tropisetron attenuates lipopolysaccharide induced neuroinflammation by inhibiting NF-κB and SP/NK1R signaling pathway. | ||
Peptides Study on the distribution sites and the molecular mechanism of analgesia after intracerebroventricular injection of rat/mouse hemokinin-1 in mice. | ||
Neoplasma miR-877-5p antagonizes the promoting effect of SP on the gastric cancer progression. | ||
Pharm Biol Stigmasterol alleviates allergic airway inflammation and airway hyperresponsiveness in asthma mice through inhibiting substance-P receptor |