TACSTD2/TROP2 Polyclonal antibody

• 

  WB analysis of HaCaT using 27360-1-AP

  HaCaT cells were subjected to SDS PAGE followed by western blot with 27360-1-AP (TACSTD2 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 27360-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27360-1-AP (TACSTD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27360-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27360-1-AP (TACSTD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 27360-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 27360-1-AP (TACSTD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 27360-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 27360-1-AP (TACSTD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HaCaT using 27360-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using TACSTD2/TROP2 antibody (27360-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

TACSTD2/TROP2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27360-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EGP 1, GA733, GA733 1, M1S1, TACSTD2, TROP2

---

Tested Applications

• Positive WB detected in: HaCaT cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

27360-1-AP targets TACSTD2/TROP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25769

  Product name: Recombinant human TACSTD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-215 aa of BC009409

  Sequence: KGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAG

• Full Name: tumor-associated calcium signal transducer 2
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC009409
• Gene Symbol: TROP2
• Gene ID (NCBI): 4070
• RRID: AB_2918122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09758
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Adv Res; Targeting Trop2 by Bruceine D suppresses breast cancer metastasis by blocking Trop2/β-catenin positive feedback loop; Authors - Wenjuan Tang
human	WB	J Extracell Vesicles; PD-L1 on large extracellular vesicles is a predictive biomarker for therapy response in tissue PD-L1-low and -negative patients with non-small cell lung cancer; Authors - Nadja Schöne