Tested Applications
Positive WB detected in | MCF-7 cells, K-562 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
CoIP | See 1 publications below |
Product Information
28713-1-AP targets TAF9B in WB, IP, IHC, CoIP, ELISA applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29633 Product name: Recombinant human TAF9B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 133-200 aa of BC010350 Sequence: IKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA Predict reactive species |
Full Name | TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa |
Calculated Molecular Weight | 28 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC010350 |
Gene Symbol | TAF9B |
Gene ID (NCBI) | 51616 |
RRID | AB_3086081 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9HBM6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription initiation factor TFIID subunit 9B (TAF9B), also names neuronal cell death-related protein 7, transcription initiation factor TFIID subunit 9-like, transcription-associated factor TAFII31L. It is essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes, may have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. The calculated MW of TAF9B is 28 kDa, 28713-1-AP can detect a band around 30 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TAF9B antibody 28713-1-AP | Download protocol |
IHC protocol for TAF9B antibody 28713-1-AP | Download protocol |
IP protocol for TAF9B antibody 28713-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |