TAF9B Polyclonal antibody, PBS Only

TAF9B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 28713-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28713-1-PBS targets TAF9B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29633

Product name: Recombinant human TAF9B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 133-200 aa of BC010350

Sequence: IKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA

Predict reactive species
Full Name TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
Calculated Molecular Weight 28 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC010350
Gene Symbol TAF9B
Gene ID (NCBI) 51616
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HBM6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Transcription initiation factor TFIID subunit 9B (TAF9B), also names neuronal cell death-related protein 7, transcription initiation factor TFIID subunit 9-like, transcription-associated factor TAFII31L. It is essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes, may have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. The calculated MW of TAF9B is 28 kDa, 28713-1-AP can detect a band around 30 kDa.

Loading...
||
New chat Able
正在加载,请稍候...