TAF9B Polyclonal antibody, PBS Only

• 

  WB analysis using 28713-1-AP (same clone as 28713-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28713-1-AP (TAF9B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28713-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 28713-1-AP (same clone as 28713-1-PBS)

  IP result of anti-TAF9B (IP:28713-1-AP, 4ug; Detection:28713-1-AP 1:500) with HeLa cells lysate 1880 ug. This data was developed using the same antibody clone with 28713-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28713-1-AP (same clone as 28713-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28713-1-AP (TAF9B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28713-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28713-1-AP (same clone as 28713-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28713-1-AP (TAF9B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28713-1-PBS in a different storage buffer formulation.

TAF9B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 28713-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

28713-1-PBS targets TAF9B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29633

  Product name: Recombinant human TAF9B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 133-200 aa of BC010350

  Sequence: IKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA

• Full Name: TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC010350
• Gene Symbol: TAF9B
• Gene ID (NCBI): 51616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBM6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transcription initiation factor TFIID subunit 9B (TAF9B), also names neuronal cell death-related protein 7, transcription initiation factor TFIID subunit 9-like, transcription-associated factor TAFII31L. It is essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes, may have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. The calculated MW of TAF9B is 28 kDa, 28713-1-AP can detect a band around 30 kDa.