TAGLN3 Polyclonal antibody

• 

  WB analysis of mouse brain using 12246-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12246-1-AP (TAGLN3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12246-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12246-1-AP (TAGLN3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12246-1-AP

  IP result of anti-TAGLN3 (IP:12246-1-AP, 4ug; Detection:12246-1-AP 1:2000) with mouse brain tissue lysate 3160 ug.

• 

  IHC staining of human brain using 12246-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12246-1-AP (TAGLN3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 12246-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12246-1-AP (TAGLN3 Antibody) at dilution of 1:200 (under 40x lens).

TAGLN3 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12246-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

Neuronal protein 22, Neuronal protein NP25, TAGLN3, transgelin 3

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

12246-1-AP targets TAGLN3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2891

  Product name: Recombinant human TAGLN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC015329

  Sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM

• Full Name: transgelin 3
• Calculated Molecular Weight: 22.4 kDa
• Observed Molecular Weight: 22.4 kDa
• GenBank Accession Number: BC015329
• Gene Symbol: TAGLN3
• Gene ID (NCBI): 29114
• RRID: AB_2199509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full length transgenlin 3 protein. It may cross-react with other two transgenlins based on the sequence similarity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Sci Rep; microRNA regulatory circuits in a mouse model of inherited retinal degeneration.; Authors - Arpad Palfi