TANC2 Polyclonal antibody

• 

  WB analysis using 31541-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31541-1-AP (TANC2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 31541-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using TANC2 antibody (31541-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

TANC2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31541-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ROLSA, rols, KIAA1636, KIAA1148

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31541-1-AP targets TANC2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35427

  Product name: Recombinant human TANC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1815-1990 aa of NM_001394998

  Sequence: AYERSCDELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDYYSPHGMLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQDNLYRQLSRDSRQGQTSPIKPKRPFVESNV

• Full Name: tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2
• Calculated Molecular Weight: 219kDa
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: NM_001394998
• Gene Symbol: TANC2
• Gene ID (NCBI): 26115
• RRID: AB_3670030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9HCD6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tetratricopeptide repeat, ankyrin repeat, and coiled-coil containing 2 (TANC2), also known as KIAA1148 and KIAA1636, belongs to the TANC family. TANC2 is a large 220 kDa protein consisting of 1990 amino acid residues. Named after its domain architecture, it comprises tetratricopeptide (TPR) and ankyrin repeats (ANK), a coiled-coil domain, and a C-terminal PDZ-interacting motif. TANC2 is widely expressed in the developing human (in excitatory neurons and radial glial cells) and rodent brain as well as in the adult brain as a scaffold in the postsynaptic density (PSD) of excitatory neurons. As such, it facilitates cell signaling downstream of cell surface glutamate receptors through multi-protein complex formation with other PSD proteins (e.g. PSD95, SHANK1), influencing dendritic spine formation and synaptic strength (PMID: 33976205, 34964047).