TANC2 Polyclonal antibody, PBS Only

TANC2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 31541-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

ROLSA, rols, KIAA1636, KIAA1148

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

31541-1-PBS targets TANC2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35427

Product name: Recombinant human TANC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1815-1990 aa of NM_001394998

Sequence: AYERSCDELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDYYSPHGMLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQDNLYRQLSRDSRQGQTSPIKPKRPFVESNV

Predict reactive species
Full Name tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2
Calculated Molecular Weight219kDa
Observed Molecular Weight220 kDa
GenBank Accession NumberNM_001394998
Gene Symbol TANC2
Gene ID (NCBI) 26115
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ9HCD6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Tetratricopeptide repeat, ankyrin repeat, and coiled-coil containing 2 (TANC2), also known as KIAA1148 and KIAA1636, belongs to the TANC family. TANC2 is a large 220 kDa protein consisting of 1990 amino acid residues. Named after its domain architecture, it comprises tetratricopeptide (TPR) and ankyrin repeats (ANK), a coiled-coil domain, and a C-terminal PDZ-interacting motif. TANC2 is widely expressed in the developing human (in excitatory neurons and radial glial cells) and rodent brain as well as in the adult brain as a scaffold in the postsynaptic density (PSD) of excitatory neurons. As such, it facilitates cell signaling downstream of cell surface glutamate receptors through multi-protein complex formation with other PSD proteins (e.g. PSD95, SHANK1), influencing dendritic spine formation and synaptic strength (PMID: 33976205, 34964047).

Loading...
||
New chat Able
正在加载,请稍候...