Tested Applications
| Positive WB detected in | A431 cells, THP-1 cells, Daudi cells, Raji cells, Ramos cells |
| Positive IP detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85138-3-RR targets TANK in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25740 Product name: Recombinant human TANK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003388 Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI Predict reactive species |
| Full Name | TRAF family member-associated NFKB activator |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC003388 |
| Gene Symbol | TANK |
| Gene ID (NCBI) | 10010 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92844 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for TANK antibody 85138-3-RR | Download protocol |
| WB protocol for TANK antibody 85138-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





