Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | mouse heart tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15067-1-AP targets TARS2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7074 Product name: Recombinant human TARS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 369-718 aa of BC000541 Sequence: EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF Predict reactive species |
| Full Name | threonyl-tRNA synthetase 2, mitochondrial (putative) |
| Calculated Molecular Weight | 81 kDa |
| Observed Molecular Weight | 81 kDa |
| GenBank Accession Number | BC000541 |
| Gene Symbol | TARS2 |
| Gene ID (NCBI) | 80222 |
| RRID | AB_2200668 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BW92 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TARS2 (mitochondrial (mt) threonyl-tRNA synthetase 2) is a class-II aminoacyl tRNA synthetase. Its canonical role is to ligate threonine to its cognate tRNA molecule during mitochondrial protein translation. TARS2 is required for the activation of mTORC1, a master regulator of cell growth and proliferation (PMID: 39509107, 37454282). TARS2 mainly localizes to mitochondria because of its N-terminal mitochondrial targeting sequence (MTS) (PMID: 33340489).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TARS2 antibody 15067-1-AP | Download protocol |
| IHC protocol for TARS2 antibody 15067-1-AP | Download protocol |
| IP protocol for TARS2 antibody 15067-1-AP | Download protocol |
| WB protocol for TARS2 antibody 15067-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TARS2 antibody (Cat# 15067-1-AP) has 6 total citations published in journals including Redox Biology, Molecular Cell, Journal of Nutrition, International Journal of Biological Markers, Bioengineered, and EMBO Molecular Medicine. Research fields span mitochondrial aminoacyl-tRNA synthetase function in diabetic muscle, mTORC1 activation, amino acid signaling in skeletal muscle, hepatocellular carcinoma proteomics, lung adenocarcinoma apoptosis, and mitochondrial disease diagnosis in fibroblasts.
| Species | Application | Title |
|---|---|---|
Redox Biol Decreased expression of mitochondrial aminoacyl-tRNA synthetases causes downregulation of OXPHOS subunits in type 2 diabetic muscle | ||
Mol Cell Mitochondrial Threonyl-tRNA Synthetase TARS2 Is Required for Threonine-Sensitive mTORC1 Activation.
| ||
J Nutr Amino Acid Signaling in Skeletal Muscle Is Blunted by Prematurity in a Piglet Model. | ||
Int J Biol Markers Potential prognostic biomarkers of hepatocellular carcinoma based on 4D label-free quantitative proteomics analysis pilot investigation | ||
Bioengineered Knockdown of mitochondrial threonyl-tRNA synthetase 2 inhibits lung adenocarcinoma cell proliferation and induces apoptosis.
| ||
EMBO Mol Med Comprehensive functional testing in fibroblasts has strong utility to diagnose mitochondrial disease. |
Reviews
What customers say
One reviewer (Vera S.) tested this antibody by Western Blot on fibroblast samples at a 1:1000 dilution, rating it 3 out of 5. She reported that the signal was quite weak at that dilution but the antibody did work overall. She also noted some unspecific binding to the protein ladder.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vera (Verified Customer) (07-14-2026) | The antibody shows quite a weak signal at a dilution of 1:1000 but it does work, there is some unspecific binding to the ladder.
|
