Tested Applications
Positive WB detected in | A431 cells, HEK-293T cells, Jurkat cells, PC-3 cells |
Positive IP detected in | Jurkat cells |
Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 13 publications below |
IF | See 6 publications below |
Product Information
17078-1-AP targets TBC1D5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10991 Product name: Recombinant human TBC1D5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 445-795 aa of BC013145 Sequence: TNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI Predict reactive species |
Full Name | TBC1 domain family, member 5 |
Calculated Molecular Weight | 795 aa, 89 kDa |
Observed Molecular Weight | 89 kDa |
GenBank Accession Number | BC013145 |
Gene Symbol | TBC1D5 |
Gene ID (NCBI) | 9779 |
RRID | AB_2199389 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92609 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TBC1D5, a member of TBC (Tre2/Bub2/Cdc16)1 domain family, is a novel retromer-interacting protein. TBC1D5 is a Rab GTPase-activating proteins (GAPs) proteins that negatively regulates VPS35/29/26 recruitment and causes Rab7 to dissociate from the membrane. TBC1D5 could bridge the endosome and autophagosome via its C-terminal LIR motif, and Rab GAPs are implicated in the reprogramming of the endocytic trafficking events under starvation-induced autophagy. The TBC1D5 protein exists 89 kDa and 91 kDa isoforms.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TBC1D5 antibody 17078-1-AP | Download protocol |
IHC protocol for TBC1D5 antibody 17078-1-AP | Download protocol |
IP protocol for TBC1D5 antibody 17078-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Adv De novo macrocyclic peptides for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex. | ||
EMBO J Control of RAB7 activity and localization through the retromer-TBC1D5 complex enables RAB7-dependent mitophagy.
| ||
J Cell Biol Retromer and TBC1D5 maintain late endosomal RAB7 domains to enable amino acid-induced mTORC1 signaling.
| ||
EMBO Rep BioID reveals an ATG9A interaction with ATG13-ATG101 in the degradation of p62/SQSTM1-ubiquitin clusters. | ||
Int J Biol Sci TBK1 Facilitates GLUT1-Dependent Glucose Consumption by suppressing mTORC1 Signaling in Colorectal Cancer Progression.
| ||
Mol Biol Cell Trafficking defects in WASH-knockout fibroblasts originate from collapsed endosomal and lysosomal networks. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH q (Verified Customer) (06-01-2021) | It is OK to detect TBC1D5 (100 kD) in both mouse and postmortem brain lysates, although there are some non specific bands.
![]() |
FH Florian (Verified Customer) (04-09-2019) | This is a very strong antibody that is reasonably specific in western blot applications. We have validated it through Crispr/Cas9 mediated knockout of TBC1D5 in HeLa cells (Jimenez-Orgaz et al, EMBOJ, 2018). While the strongest band is indeed TBC1D5, as our knockout confirms, it also produces several weaker, unspecific bands on membranes blocked with 5% milk. Because of the unspecific bands, I rate it with four stars instead of five. We have not tested it for immunofluorescence. Overall, it is a very good antibody that will probably also work at much lower dilutions than 1:1000. Diluting it further may also reduce the unspecific signal.
|
FH David (Verified Customer) (02-28-2019) | Hela cells stained with anti-TBC1D5 (green) and Hoechst (blue)
![]() |