Tested Applications
Positive WB detected in | human brain tissue, HeLa cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:1500 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
12304-1-AP targets TBCA in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2950 Product name: Recombinant human TBCA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC018210 Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA Predict reactive species |
Full Name | tubulin folding cofactor A |
Calculated Molecular Weight | 108 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC018210 |
Gene Symbol | TBCA |
Gene ID (NCBI) | 6902 |
RRID | AB_2199402 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75347 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TBCA antibody 12304-1-AP | Download protocol |
IHC protocol for TBCA antibody 12304-1-AP | Download protocol |
IP protocol for TBCA antibody 12304-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Cancer Tubulin cofactor a functions as a novel positive regulator of ccRCC progression, invasion and metastasis. | ||
Histochem Cell Biol Spatio-temporal distribution of tubulin-binding cofactors and posttranslational modifications of tubulin in the cochlea of mice. | ||
Front Genet Target-Sequencing of Female Infertility Pathogenic Gene Panel and a Novel TUBB8 Loss-of-Function Mutation. | ||
Oncol Rep ERp29 counteracts the suppression of malignancy mediated by endoplasmic reticulum stress and promotes the metastasis of colorectal cancer. |