TBCCD1 Polyclonal antibody

• 

  WB analysis using 21429-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21429-1-AP (TBCCD1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 21429-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using TBCCD1 antibody (21429-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

TBCCD1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21429-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

TBCC domain containing 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, human testis tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21429-1-AP targets TBCCD1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16032

  Product name: Recombinant human TBCCD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 208-557 aa of BC025748

  Sequence: AVVALSFLIEGTISRARKIYPLHELALWQPLHADSGFSKISKTFSFYKLETWLRSCLTGNPFGTSACLKSGKKLAWAHQVEGTTKRAKIACNTHVAPRMHRLVVMSQVYKQTLAKSSDTLAGAHVKIHRCNESFIYLLSPLRSVTIEKCRNSIFVLGPVGTTLHLHSCDNVKVIAVCHRLSISSTTGCIFHVLTPTRPLILSGNQTVTFAPFHTHYPMLEDHMARTGLATVPNYWDNPMVVCRENSDTRVFQLLPPCEFYVFIIPFEMEGDTTEIPGGLPSVYQKALGQREQKIQIWQKTVKEAHLTKDQRKQFQVLVENKFYEWLINTGHRQQLDSLVPPAAGSKQAAG

• Full Name: TBCC domain containing 1
• Calculated Molecular Weight: 557 aa, 64 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC025748
• Gene Symbol: TBCCD1
• Gene ID (NCBI): 55171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NVR7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBCC-domain containing 1 (TBCCD1) belongs to the tubulin-binding cofactor C (TBCC) family, which is a new human pericentriolar matrix component (PMID: 24101722). TBCCD1 localizes at the centrosome and at the spindle midzone, midbody and basal bodies of primary and motile cilia. Knockdown of TBCCD1 in RPE-1 cells caused the dissociation of the centrosome from the nucleus and disorganization of the Golgi apparatus. TBCCD1 is a key regulator of centrosome positioning and consequently of internal cell organization (PMID: 20168327).