Tested Applications
Positive WB detected in | HT-29 cells, DU 145 cells, human placenta tissue, MCF-7 cells, PC-3 cells, Hela cells |
Positive IHC detected in | human prostate cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 1 publications below |
Product Information
27159-1-AP targets TBXA2R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25670 Product name: Recombinant human TBXA2R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC074750 Sequence: MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCR Predict reactive species |
Full Name | thromboxane A2 receptor |
Calculated Molecular Weight | 343aa,37 kDa; 1043aa,113 kDa |
Observed Molecular Weight | 50-60 kDa |
GenBank Accession Number | BC074750 |
Gene Symbol | TBXA2R |
Gene ID (NCBI) | 6915 |
RRID | AB_2880782 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P21731 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TBXA2R, also named as thromboxane A2 receptor, TXA2-R and Prostanoid TP receptor, belongs to G-protein coupled receptor 1 family. Thromboxane A2 receptor is a key molecule in hemostasis as its abnormality leads to bleeding disorders. The TXA2-R receptor is linked via a guanine nucleotide-binding protein (G protein) to phospholipase C (PLC), which hydrolyses phosphoinositides to the two potent stimulatory second messengers inositol 1,4,5-triphosphate (IP3) and diacylglycerol. IP3 causes increases in cytoplasmic free calcium and diacylglycerol causes activation of protein kinase C. In the kidney, the binding of TXA2-R to glomerular TP receptors causes intense vasoconstriction. The two isoforms expressed in cultured cells show similar ligand binding characteristics and phospholipase C (PLC) activation but oppositely regulate adenylyl cyclase activity (PMID: 8613548).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TBXA2R antibody 27159-1-AP | Download protocol |
IHC protocol for TBXA2R antibody 27159-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Am J Respir Crit Care Med Thromboxane-Prostanoid Receptor Signaling Drives Persistent Fibroblast Activation in Pulmonary Fibrosis
| ||
Front Endocrinol (Lausanne) The Arachidonic Acid Metabolism Mechanism Based on UPLC-MS/MS Metabolomics in Recurrent Spontaneous Abortion Rats. | ||
Eur J Pharmacol Resveratrol attenuates cyclosporin A-induced upregulation of the thromboxane A2 receptor and hypertension via the AMPK/SIRT1 and MAPK/NF-κB pathways in the rat mesenteric artery | ||
Arch Dermatol Res The effect of selinexor on prostaglandin synthesis in virus-positive Merkel cell carcinoma cell lines |