• Featured Product
  • KD/KO Validated

TBXA2R Polyclonal antibody

TBXA2R Polyclonal Antibody for WB, IHC, ELISA
Cat No. 27159-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Prostanoid TP receptor, TBXA2R, thromboxane A2 receptor, TP, TXA2 R

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, DU 145 cells, human placenta tissue, MCF-7 cells, PC-3 cells, Hela cells
Positive IHC detected inhuman prostate cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27159-1-AP targets TBXA2R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25670

Product name: Recombinant human TBXA2R protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-106 aa of BC074750

Sequence: MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCR

Predict reactive species
Full Name thromboxane A2 receptor
Calculated Molecular Weight343aa,37 kDa; 1043aa,113 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC074750
Gene Symbol TBXA2R
Gene ID (NCBI) 6915
RRIDAB_2880782
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21731
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBXA2R, also named as thromboxane A2 receptor, TXA2-R and Prostanoid TP receptor, belongs to G-protein coupled receptor 1 family. Thromboxane A2 receptor is a key molecule in hemostasis as its abnormality leads to bleeding disorders. The TXA2-R receptor is linked via a guanine nucleotide-binding protein (G protein) to phospholipase C (PLC), which hydrolyses phosphoinositides to the two potent stimulatory second messengers inositol 1,4,5-triphosphate (IP3) and diacylglycerol. IP3 causes increases in cytoplasmic free calcium and diacylglycerol causes activation of protein kinase C. In the kidney, the binding of TXA2-R to glomerular TP receptors causes intense vasoconstriction. The two isoforms expressed in cultured cells show similar ligand binding characteristics and phospholipase C (PLC) activation but oppositely regulate adenylyl cyclase activity (PMID: 8613548).

Protocols

Product Specific Protocols
WB protocol for TBXA2R antibody 27159-1-APDownload protocol
IHC protocol for TBXA2R antibody 27159-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Am J Respir Crit Care Med

Thromboxane-Prostanoid Receptor Signaling Drives Persistent Fibroblast Activation in Pulmonary Fibrosis

Authors - Toshio Suzuki
  • KO Validated
ratWB, IHC

Front Endocrinol (Lausanne)

The Arachidonic Acid Metabolism Mechanism Based on UPLC-MS/MS Metabolomics in Recurrent Spontaneous Abortion Rats.

Authors - Meihe Li
ratWB

Eur J Pharmacol

Resveratrol attenuates cyclosporin A-induced upregulation of the thromboxane A2 receptor and hypertension via the AMPK/SIRT1 and MAPK/NF-κB pathways in the rat mesenteric artery

Authors - Qian Li
human,mouse

Arch Dermatol Res

The effect of selinexor on prostaglandin synthesis in virus-positive Merkel cell carcinoma cell lines

Authors - Deepika Narayanan
Loading...
||
New chat Able
正在加载,请稍候...