Product Information
17286-1-AP targets TCEAL8 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag11081 Product name: Recombinant human TCEAL8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC035573 Sequence: MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP Predict reactive species |
Full Name | transcription elongation factor A (SII)-like 8 |
Calculated Molecular Weight | 117 aa, 14 kDa |
GenBank Accession Number | BC035573 |
Gene Symbol | TCEAL8 |
Gene ID (NCBI) | 90843 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IYN2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |