Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, mouse testis tissue, rat testis tissue |
| Positive IHC detected in | human breast cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12450-1-AP targets TCEB1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3087 Product name: Recombinant human TCEB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC013809 Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC Predict reactive species |
| Full Name | transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) |
| Calculated Molecular Weight | 112 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC013809 |
| Gene Symbol | TCEB1 |
| Gene ID (NCBI) | 6921 |
| RRID | AB_2201139 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15369 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCEB1, also named as RNA polymerase II transcription factor SIII subunit C, belongs to the SKP1 family. It mediates the ubiquitination of ECS-E3 ubiquitin-protein ligase complexes. TCEB1 is overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. TCEB1 also promotes invasion of prostate cancer cells (PMID:18844214).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TCEB1 antibody 12450-1-AP | Download protocol |
| IHC protocol for TCEB1 antibody 12450-1-AP | Download protocol |
| WB protocol for TCEB1 antibody 12450-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TCEB1 Polyclonal antibody (Cat# 12450-1-AP) has 10 citations published in journals including Nature, Nature Chemical Biology, Cell Death & Differentiation, PNAS, J Mol Cell Biol, Am J Pathol, Evid Based Complement Alternat Med, and bioRxiv. Research fields span ubiquitin-mediated protein degradation, ferroptosis, colorectal and prostate cancer, viral pathogenesis, APP lysosomal sorting, cysteine metabolism, and osteoporosis.
| Species | Application | Title |
|---|---|---|
Nat Chem Biol SINE compounds activate exportin 1 degradation through an allosteric mechanism.
| ||
Cell Death Differ CRL2-KLHDC3 E3 ubiquitin ligase complex suppresses ferroptosis through promoting p14ARF degradation. | ||
Cell Death Differ USP51 facilitates colorectal cancer stemness and chemoresistance by forming a positive feed-forward loop with HIF1A | ||
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
J Mol Cell Biol APP ubiquitination by VHL protein is essential for MVB sorting and lysosomal degradation. |
