Tested Applications
Positive WB detected in | HeLa cells, MCF-7 cells, mouse testis tissue, rat testis tissue |
Positive IHC detected in | human breast cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
12450-1-AP targets TCEB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3087 Product name: Recombinant human TCEB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC013809 Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC Predict reactive species |
Full Name | transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) |
Calculated Molecular Weight | 112 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC013809 |
Gene Symbol | TCEB1 |
Gene ID (NCBI) | 6921 |
RRID | AB_2201139 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15369 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCEB1, also named as RNA polymerase II transcription factor SIII subunit C, belongs to the SKP1 family. It mediates the ubiquitination of ECS-E3 ubiquitin-protein ligase complexes. TCEB1 is overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. TCEB1 also promotes invasion of prostate cancer cells (PMID:18844214).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TCEB1 antibody 12450-1-AP | Download protocol |
IHC protocol for TCEB1 antibody 12450-1-AP | Download protocol |
IF protocol for TCEB1 antibody 12450-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
Cell Death Differ CRL2-KLHDC3 E3 ubiquitin ligase complex suppresses ferroptosis through promoting p14ARF degradation. | ||
Am J Pathol A 12-gene expression signature is associated with aggressive histological in prostate cancer: SEC14L1 and TCEB1 genes are potential markers of progression. | ||
Evid Based Complement Alternat Med Antiosteoporotic Effects of Huangqi Sanxian Decoction in Cultured Rat Osteoblasts by Proteomic Characterization of the Target and Mechanism. | ||
bioRxiv The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||