TCF7L1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 14519-1-AP (same clone as 14519-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14519-1-AP (TCF7L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14519-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14519-1-AP (same clone as 14519-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14519-1-AP (TCF7L1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14519-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14519-1-AP (same clone as 14519-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14519-1-AP (TCF7L1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14519-1-AP (same clone as 14519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14519-1-AP (TCF7L1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14519-1-AP (same clone as 14519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14519-1-AP (TCF7L1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14519-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 14519-1-AP (same clone as 14519-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using TCF7L1 antibody (14519-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 14519-1-PBS in a different storage buffer formulation.

TCF7L1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14519-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

14519-1-PBS targets TCF7L1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5983

  Product name: Recombinant human TCF7L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 238-587 aa of BC058894

  Sequence: GAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSRQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH

• Full Name: transcription factor 7-like 1 (T-cell specific, HMG-box)
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC058894
• Gene Symbol: TCF7L1
• Gene ID (NCBI): 83439
• RRID: AB_2287033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCS4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCF7L1 is one of TCF/LEF transcription factors that are mediators of the Wnt signaling pathway and are antagonized by the TGF-beta signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It's necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis