Tested Applications
Positive WB detected in | Raji cells |
Positive IHC detected in | human tonsillitis tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
10475-1-AP targets TCL1A in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0786 Product name: Recombinant human TCL1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC005831 Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Predict reactive species |
Full Name | T-cell leukemia/lymphoma 1A |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 14-16 kDa |
GenBank Accession Number | BC005831 |
Gene Symbol | TCL1A |
Gene ID (NCBI) | 8115 |
RRID | AB_2255885 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P56279 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCL1A, also named TCL1 and p14 TCL1, enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. TCL1A immunodetection is an independent marker of adverse outcome that could be used in routine settings for the management of DLCL patients. TCL1A expression is correlated with shorter time to treatment in chronic lymphocytic leukemia cases and shorter lymphoma-specific survival in mantle cell lymphoma series. It is a potential therapeutic target.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TCL1A antibody 10475-1-AP | Download protocol |
IHC protocol for TCL1A antibody 10475-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |