TCR α/β Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87509-1-RR (same clone as 87509-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87509-1-RR (TCR α/β antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87509-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87509-1-RR (same clone as 87509-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87509-1-RR (TCR α/β antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87509-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 87509-1-RR (same clone as 87509-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 87509-1-RR (TCR α/β antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87509-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 87509-1-RR (same clone as 87509-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 87509-1-RR (TCR α/β antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87509-1-PBS in a different storage buffer formulation.

TCR α/β Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87509-1-PBS

Clone No.252782H5

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

87509-1-PBS targets TCR α/β in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg9184

  Product name: Recombinant human TCR α/β protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 10010316 of

  Sequence: TRAC IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS 1-115 TRBC DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA 1-144

• Full Name: TCR α/β
• Observed Molecular Weight: 35 kDa
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCR α/β (T-cell receptor α/β heterodimer) is a core molecule of the adaptive immune system, formed by the disulfide bond linkage of α and β transmembrane polypeptide chains. It is present on the surface of most mature T cells and non-covalently associates with the CD3 complex to form the complete T-cell receptor (TCR-CD3 complex). Its primary function is to recognize antigen peptides presented by major histocompatibility complex (MHC) molecules. The genes encoding TCR α/β undergo V(D)J recombination, generating an extraordinarily high degree of diversity, enabling the immune system to recognize a vast array of antigens. TCR α/β plays a decisive role in T-cell development, activation, clonal selection, and immune responses, making it a fundamental target in immunology research and a key molecule in tumor immunotherapy, such as TCR-T therapy.