TDO2 Recombinant monoclonal antibody, PBS Only

TDO2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83236-2-PBS
Clone No.240068C2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

240068C2, EC:1.13.11.11, TDO, TO, TPH2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83236-2-PBS targets TDO2 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8531

Product name: Recombinant human TDO2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-406 aa of BC005355

Sequence: QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Predict reactive species
Full Name tryptophan 2,3-dioxygenase
Calculated Molecular Weight 406 aa, 48 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberBC005355
Gene Symbol TDO2
Gene ID (NCBI) 6999
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48775
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TDO2 (tryptophan 2,3-dioxygenase), IDO1 (indoleamine 2,3-dioxygenase 1) and IDO2 are three enzymes that catalyze the amino acid tryptophan into kynurenine in the kynurenine pathway (PMID: 23090118, 28469468). TDO2 plays an important role in neurological diseases such as Alzheimer's disease, Parkinson's disease and autism. Overexpression of TDO2 promoted tumor cell survival and was correlated with tumor grade and poor prognosis in triple negative breast cancer, brain tumors and esophageal squamous cell carcinoma. TDO2 may be a potential therapeutic target in some cancers. (PMID: 21976023, 30134247)

Loading...
||
New chat Able
正在加载,请稍候...