Product Information
83236-2-PBS targets TDO2 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag8531 Product name: Recombinant human TDO2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 55-406 aa of BC005355 Sequence: QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD Predict reactive species |
| Full Name | tryptophan 2,3-dioxygenase |
| Calculated Molecular Weight | 406 aa, 48 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC005355 |
| Gene Symbol | TDO2 |
| Gene ID (NCBI) | 6999 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48775 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TDO2 (tryptophan 2,3-dioxygenase), IDO1 (indoleamine 2,3-dioxygenase 1) and IDO2 are three enzymes that catalyze the amino acid tryptophan into kynurenine in the kynurenine pathway (PMID: 23090118, 28469468). TDO2 plays an important role in neurological diseases such as Alzheimer's disease, Parkinson's disease and autism. Overexpression of TDO2 promoted tumor cell survival and was correlated with tumor grade and poor prognosis in triple negative breast cancer, brain tumors and esophageal squamous cell carcinoma. TDO2 may be a potential therapeutic target in some cancers. (PMID: 21976023, 30134247)



