Tested Applications
Positive WB detected in | mouse colon tissue, mouse lung tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 12 publications below |
IHC | See 1 publications below |
ChIP | See 2 publications below |
Product Information
21159-1-AP targets TEAD2 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14074 Product name: Recombinant human TEAD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 121-251 aa of BC051301 Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR Predict reactive species |
Full Name | TEA domain family member 2 |
Calculated Molecular Weight | 447 aa, 49 kDa |
Observed Molecular Weight | 55-65 kDa |
GenBank Accession Number | BC051301 |
Gene Symbol | TEAD2 |
Gene ID (NCBI) | 8463 |
RRID | AB_2861186 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15562 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TEAD2 belongs to a protein family that share the TEA/ATTS domain. It acts as a transcriptional factor by cooperatively binding to the GT-IIC and Sph(I 1 II) enhansons in the simian virus 40 (SV40) enhancer. Also it can modulate SV40 late transcription together with large T antigen. The transcriptional activity of TEAD2 required several regions of the proteins , a TBP-associated factors and a limiting transcriptional intermediary factors. TEAD2 also preforms an essential role in the Hippo signaling pathway. TEAD2 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. TEAD2 is strongly expressed in human ovarian carcinoma cell line.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TEAD2 antibody 21159-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
ACS Nano Hepatic Stellate Cell- and Liver Microbiome-Specific Delivery System for Dihydrotanshinone I to Ameliorate Liver Fibrosis | ||
Aging (Albany NY) Integrative bioinformatics and experimental analysis revealed TEAD as novel prognostic target for hepatocellular carcinoma and its roles in ferroptosis regulation.
| ||
Oncol Rep 17‑AAG synergizes with Belinostat to exhibit a negative effect on the proliferation and invasion of MDA‑MB‑231 breast cancer cells. | ||
Int J Gen Med Significance of TEAD Family in Diagnosis, Prognosis and Immune Response for Ovarian Serous Carcinoma.
| ||
Cell Rep YTHDF2/3 Are Required for Somatic Reprogramming through Different RNA Deadenylation Pathways. |