Tested Applications
| Positive WB detected in | mouse colon tissue, mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21159-1-AP targets TEAD2 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14074 Product name: Recombinant human TEAD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 121-251 aa of BC051301 Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR Predict reactive species |
| Full Name | TEA domain family member 2 |
| Calculated Molecular Weight | 447 aa, 49 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC051301 |
| Gene Symbol | TEAD2 |
| Gene ID (NCBI) | 8463 |
| RRID | AB_2861186 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15562 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TEAD2 belongs to a protein family that share the TEA/ATTS domain. It acts as a transcriptional factor by cooperatively binding to the GT-IIC and Sph(I 1 II) enhansons in the simian virus 40 (SV40) enhancer. Also it can modulate SV40 late transcription together with large T antigen. The transcriptional activity of TEAD2 required several regions of the proteins , a TBP-associated factors and a limiting transcriptional intermediary factors. TEAD2 also preforms an essential role in the Hippo signaling pathway. TEAD2 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. TEAD2 is strongly expressed in human ovarian carcinoma cell line.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TEAD2 antibody 21159-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-TEAD (Cat# 21159-1-AP) has 20 citations across journals including Nature Communications, Signal Transduction and Targeted Therapy, ACS Nano, Advanced Science, Science Advances, Cell Death & Disease, Apoptosis, Cell Reports, Journal of Cell Biology, Cancer Cell, and Journal of Biological Chemistry. Research fields span cancer biology (hepatocellular, nasopharyngeal, ovarian, gastric, and breast carcinoma), ferroptosis, YAP/TEAD signaling, bone biology, liver fibrosis, cardiac hypertrophy, and exosome-mediated tissue regeneration.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther CDK7-YAP-LDHD axis promotes D-lactate elimination and ferroptosis defense to support cancer stem cell-like properties | ||
ACS Nano Hepatic Stellate Cell- and Liver Microbiome-Specific Delivery System for Dihydrotanshinone I to Ameliorate Liver Fibrosis | ||
Adv Sci (Weinh) SUMOylation of TEAD1 Modulates the Mechanism of Pathological Cardiac Hypertrophy | ||
Adv Sci (Weinh) TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration. | ||
Reviews
What customers say
All three reviews are 5-star ratings. Users report consistent success with this antibody across Western Blot, Immunohistochemistry, Immunofluorescence, and Flow Cytometry. Typical dilutions range from 1:800 to 1:1000. Reviewers describe it as a reliable primary antibody that performs well for their experiments, with one noting a positive first-time experience. Overall, customers express satisfaction with its performance and recommend it for routine use.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (09-03-2026) | primary antibody for the project, does great job!
|
Mounika (Verified Customer) (03-23-2026) | Very good antibody, used for our western blots mostly, happy for it!
|
Soumya (Verified Customer) (10-29-2025) | Had a good experience using for the first for my experiment
|
